Transcript | Ll_transcript_110937 |
---|---|
CDS coordinates | 1-495 (+) |
Peptide sequence | DATSAFNPIAAQTKDFDPTGWELALVTAPSTNISSVNERQLAGGLDTLTLNSLYDEAAYRSTQQPVYGAPAAPNPFEVQDPFALSTSVLPPQNAQLASMGQQQVNPFGPVQFFQQPQQPQQQQQQHMLMDPANPFVDATGYEPFPANHVSHPQNNNPFGNPGLL* |
ORF Type | 5prime_partial |
Blastp | Putative clathrin assembly protein At2g01600 from Arabidopsis with 48.24% of identity |
---|---|
Blastx | Putative clathrin assembly protein At1g14910 from Arabidopsis with 70.37% of identity |
Eggnog | Clathrin assembly protein(ENOG410XQ90) |
Kegg | Link to kegg annotations (AT2G01600) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437372.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer