Protein coding transcript 198675

• Transcript: Ll_transcript_110940
• CDS coordinates: 1-495 (+)
• Peptide sequence: DATSAFNPIAAQTKDFDPTGWELALVTAPSTNISSVNERQLAGGLDTLTLNSLYDEAAYRSTQQPVYGAPAAPNPFEVQDPFALSTSVLPPQNAQLASMGQQQVNPFGPVQFFQQPQQPQQQQQQHMLMDPANPFVDATGYEPFPANHVSHPQNNNPFGNPGLL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_110940

• Blastp: Putative clathrin assembly protein At2g01600 from Arabidopsis with 48.24% of identity
• Blastx: Putative clathrin assembly protein At1g14910 from Arabidopsis with 70.37% of identity
• Eggnog: Clathrin assembly protein(ENOG410XQ90)
• Kegg: Link to kegg annotations (AT2G01600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437372.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;