Protein coding transcript 198678

• Transcript: Ll_transcript_110953
• CDS coordinates: 50-769 (+)
• Peptide sequence: MGTTCKVTNTGSEPFDDPTLYRSIVGALQYATITRPDLAFSVNKVCQFMSQPLQQQWSAVKRVLKYLQGSSTFGLHLKPAHSSSPLPILVWCDADWTSDPNDRKSISGACIFLGPNIVRSKKQQIVSRSSTEVEYRSLALASQEVVDLSTDSYQTPLILCDNLSTVVVAHNPVLHNRTKHIELDLFFVRDRIQSKALQVKHIPSEHQTADVLTKPLSSSKLISMRKNLRVIDVLSLKDY*
• ORF Type: complete

Annotations of Ll_transcript_110953

• Blastp: Uncharacterized mitochondrial protein AtMg00810 from Arabidopsis with 47.37% of identity
• Blastx: Uncharacterized mitochondrial protein AtMg00810 from Arabidopsis with 43.64% of identity
• Eggnog: Retrotransposon protein(COG2801)
• Kegg: Link to kegg annotations (ArthMp070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442250.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;