Protein coding transcript 19868

• Transcript: Ll_transcript_418518
• CDS coordinates: 126-707 (+)
• Peptide sequence: MASRDKEQAPRNHHHHLLSSLVVRPEVTSVADTGADRGGDFEPGEFRRDHRSPYSRSDRYSGDAGYRIRAGSASPVHRRDANHRFGSDYNHLSQSRGYGGGRDPGRYRDPSPPYFRGKVGGRPVGRAFDRPGFVPGLARGEGNSRNNPNVRPREGDWICPDIRCGNLNFARRDYCNKCNRSRPAPAESPRRAYP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_418518

• Blastp: TATA-binding protein-associated factor 2N from Homo with 62.5% of identity
• Blastx: TATA-binding protein-associated factor 2N from Homo with 64.29% of identity
• Eggnog: TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor(ENOG4111P4G)
• Kegg: Link to kegg annotations (8148)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448374.1)
• Pfam: Zn-finger in Ran binding protein and others (PF00641.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;