Protein coding transcript 198708

• Transcript: Ll_transcript_111258
• CDS coordinates: 3-605 (-)
• Peptide sequence: VGVWDQVTGKQIDFFYEPLGWSLGDADKLQWLGGNNCLLVATMFPRKDNCYISLLDFREKNMVWCWSDMGAPATMAVDEKRVRDAIAMEDNNSICVVNEFEDLGFMDLRMSAATSIRWSSRSRLMKGKMPEEPCYPKLARHGGQLFSSMNDCISVFCGPEWVLTSRLRRSYGGSICDFSIGGDRLFALHSEENVFDIWETP
• ORF Type: internal

Annotations of Ll_transcript_111258

• Blastp: BTB/POZ domain-containing protein At2g24240 from Arabidopsis with 85.07% of identity
• Blastx: BTB/POZ domain-containing protein At2g24240 from Arabidopsis with 85.07% of identity
• Eggnog: Potassium channel tetramerisation domain containing 3(ENOG410XSWI)
• Kegg: Link to kegg annotations (AT2G24240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463395.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;