Protein coding transcript 19872

• Transcript: Ll_transcript_418520
• CDS coordinates: 1955-2410 (+)
• Peptide sequence: MLNFASNSVSCLFSDFIVFVFPGYRIRAGSASPVHRRDANHRFGSDYNHLSQSRGYGGGRDPGRYRDPSPPYFRGKVGGRPVGRAFDRPGFVPGLARGEGNSRNNPNVRPREGDWICPDIRCGNLNFARRDYCNKCNRSRPAPAESPRRAYP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_418520

• Blastp: Zinc finger Ran-binding domain-containing protein 2 from Pongo with 55% of identity
• Blastx: -
• Eggnog: Zinc finger, RAN-binding domain containing 2(ENOG4111QXA)
• Kegg: Link to kegg annotations (100174707)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436628.1)
• Pfam: Zn-finger in Ran binding protein and others (PF00641.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;