Transcript | Ll_transcript_112337 |
---|---|
CDS coordinates | 772-1248 (+) |
Peptide sequence | MLLRHTRKFEPFGICKLLNTFFVTTLFFLWFILYTELWCWDVENAQFIKTASYLFQAYELWREGRGVEFLDPLLDDTTLPFKIMRRMQIALLCVQENSADRPSMLEFDSMFKNDGAVISTPKVPGFSIKKKEHEEETSYSGIKYSSINDVTVSQLAPR* |
ORF Type | complete |
Blastp | Cysteine-rich receptor-like protein kinase 14 from Arabidopsis with 31.85% of identity |
---|---|
Blastx | G-type lectin S-receptor-like serine/threonine-protein kinase At1g11330 from Arabidopsis with 64.71% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT4G23220) |
CantataDB | Link to cantataDB annotations (CNT0000159) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_016199915.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer