Protein coding transcript 198755

• Transcript: Ll_transcript_112701
• CDS coordinates: 291-722 (+)
• Peptide sequence: MHLQIFQWLESMPLELEGYIRPGCTILTIFISMPKTMWINILEDPLHYVCDLVAPRKMLSGRGSALVHLDDMIFRVMKDGTSVMKVEVNMQAPRLHYVHPTYFEAGKPMEFVACGSNLLQSKFRCEIITSSKCSFDVVAYCIF*
• ORF Type: complete

Annotations of Ll_transcript_112701

• Blastp: Squamosa promoter-binding-like protein 7 from Arabidopsis with 58.2% of identity
• Blastx: Squamosa promoter-binding-like protein 7 from Arabidopsis with 51.93% of identity
• Eggnog: Squamosa promoter-binding-like protein(ENOG4111YFE)
• Kegg: Link to kegg annotations (AT5G18830)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425953.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;