Protein coding transcript 198818

• Transcript: Ll_transcript_110201
• CDS coordinates: 167-778 (+)
• Peptide sequence: MAPLPMMNDTTFANGGPSNTPPFHLSEIWQFPPPALTDSGIGPRRPPFEQGLSHFSGFGPNRDVPRNDPINSEHMAPIPNRKRRDSDEESVKAASTSNGGGANAMSDGGDGKRVKTTGDNRNESGKGETETSSGKHEEQKQTTPEPHPKQDYIHVRARRGQATDSHSLAERVILFLPIPPLLFVLCNSFCYAIHFENFRTTAS*
• ORF Type: complete

Annotations of Ll_transcript_110201

• Blastp: Transcription factor BPE from Arabidopsis with 37.84% of identity
• Blastx: Transcription factor BPE from Arabidopsis with 91.67% of identity
• Eggnog: Transcription factor(ENOG410YAFX)
• Kegg: Link to kegg annotations (AT1G59640)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422701.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;