Protein coding transcript 198821

• Transcript: Ll_transcript_110197
• CDS coordinates: 383-967 (+)
• Peptide sequence: MDPLPMINDTSFSNGGPTNTTPFHLSEIWQFPATGVSGISDNGLGLRTSSFGHGLGQFGDFGPTRHVSGNDPINLERRAIILNKKRRDSEEESAKVVSTSNGGGISAMSDGGDRKRVKTTGSNINESGKGETETSSGKHAEQEQTTPEPPLKQDYIHVRARRGQATDSHSLAERVIHMFPSFVYTNIPLCGSAM*
• ORF Type: complete

Annotations of Ll_transcript_110197

• Blastp: Transcription factor BPE from Arabidopsis with 42.86% of identity
• Blastx: Transcription factor BPE from Arabidopsis with 42.54% of identity
• Eggnog: Transcription factor(ENOG410YAFX)
• Kegg: Link to kegg annotations (AT1G59640)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445528.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;