| Transcript | Ll_transcript_110205 |
|---|---|
| CDS coordinates | 383-784 (+) |
| Peptide sequence | MDPLPMINDTSFSNGGPTNTTPFHLSEIWQFPATGVSGISDNGLGLRTSSFGHGLGQFGDFGPTRHVSGNDPINLERRAIILNKKRRDSEEESAKVVSTSNGGGISAMVLKIYDFFCFDLLQFGNIIKKMDLS* |
| ORF Type | complete |
| Blastp | Transcription factor BPE from Arabidopsis with 40.57% of identity |
|---|---|
| Blastx | Transcription factor BHLH094 from Oryza sativa with 57.53% of identity |
| Eggnog | Transcription factor(ENOG410YAFX) |
| Kegg | Link to kegg annotations (AT1G59640) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019445528.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer