Transcript | Ll_transcript_110860 |
---|---|
CDS coordinates | 3-755 (+) |
Peptide sequence | KTHRIASVKNRVPISITMDHAELTTDQVLTRDIPWETYMSTKLISGTSLQLFRRYDHRPESVRAQLLDDDGPAYVQVFIHVLRDIHKEDTVEYVLALIDEMLSANPKRARLFHHSTLADEDTYEPFLRLLWKGNWFIQEKSCKILALILSARPKNQNGIVSNGEASNSKKPFSTIDDALIGLVKWLCEQLKKPSHPNRGVPTAVNCLSTILKEPVVRSSFVQADGVKLLVPLISPASNQQSIQVSLLDYI* |
ORF Type | 5prime_partial |
Blastp | V-type proton ATPase subunit H from Arabidopsis with 73.57% of identity |
---|---|
Blastx | V-type proton ATPase subunit H from Arabidopsis with 73.57% of identity |
Eggnog | subunit (H(COG5231) |
Kegg | Link to kegg annotations (AT3G42050) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421164.1) |
Pfam | V-ATPase subunit H (PF03224.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer