Protein coding transcript 1989

• Transcript: Ll_transcript_355418
• CDS coordinates: 58-507 (+)
• Peptide sequence: MATSLNAKRLMALSLGATPVIISSHPESAKEILCGPCFSDRPIKESAKILMFERAIGFAPSGTYWRHLRRIASSHMFSPRRIQGLESLRQNVADNMLMRVFKEMEEKGVVEVRGILQEGSLSNILESVFGTNGCLSEYQSGELGNMVKEG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_355418

• Blastp: Cytochrome P450 78A1 from Zea with 49.32% of identity
• Blastx: Cytochrome P450 78A4 from Pinus with 50% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AAA61607)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431650.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;