Transcript | Ll_transcript_110737 |
---|---|
CDS coordinates | 156-746 (+) |
Peptide sequence | MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSIVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLLSRASYENISKKWIPELRHYAPTVPIVLVGTKLDLREDRQYLIDHPQATPITTAQGEELKKAIGAAVYLECSSKTQQNVKAVFDAAIKVVLQPPKPKKKRKKTRSCFFL* |
ORF Type | complete |
Blastp | Rac-like GTP-binding protein RAC2 from Lotus with 97.96% of identity |
---|---|
Blastx | Rac-like GTP-binding protein RAC2 from Lotus with 97.96% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432137.1) |
Pfam | Ras family (PF00071.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer