Protein coding transcript 1990

• Transcript: Ll_transcript_355419
• CDS coordinates: 72-854 (+)
• Peptide sequence: MDFHGVKRRCHKLAARVTNLVGQIVEERKRNGDFVGKNDFLSTLLSLPKEERLGDSDMVAVLWEMIFRGTDTVAILLEWIMARMVLHQEIQMKACQEIETCIDQNGHLQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARLANQDTHVDKVLVPVGTTAMVNMWAISHDSTIWEDPWAFKPERFMKEDVSIMGSDLRLAPFGAGRRVCPGTMLGLTTVHLWLGRFLHHFTWLPAQRVSLSECLKLSLEMKTPLRCVVVGR*
• ORF Type: complete

Annotations of Ll_transcript_355419

• Blastp: Cytochrome P450 78A5 from Arabidopsis with 62.26% of identity
• Blastx: Cytochrome P450 78A5 from Arabidopsis with 61.07% of identity
• Eggnog: Cytochrome p450(COG2124)
• Kegg: Link to kegg annotations (AT1G13710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431650.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;