Protein coding transcript 19900

• Transcript: Ll_transcript_417927
• CDS coordinates: 300-725 (+)
• Peptide sequence: MMDVILHIYDVTNSGSDKTNNTILQINKIFKDGIGLGGIFHSAVQVYGDDEWSFGFCEQGTGVFSCPSGKNPMYTYRESLTLGKTNLSIFKVNQILRELSREWPGNSYDLLARNCNHFCDELCERLGVLKLPGKHLPILCF*
• ORF Type: complete

Annotations of Ll_transcript_417927

• Blastp: DeSI-like protein At4g17486 from Arabidopsis with 32.61% of identity
• Blastx: DeSI-like protein At4g17486 from Arabidopsis with 31.91% of identity
• Eggnog: Desumoylating isopeptidase(ENOG4111H3Z)
• Kegg: Link to kegg annotations (AT4G17486)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449692.1)
• Pfam: PPPDE putative peptidase domain (PF05903.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;