Transcript | Ll_transcript_111663 |
---|---|
CDS coordinates | 273-638 (+) |
Peptide sequence | MSGIGKTTLADVVYNEIKSKFDFSCFLPNVRAASNEGDQGLVRLQDKLISRLKPMSMIIDTLRQGKYMIKNFLQNKKVLLVLDDVNAEIQLEYMAGNKNWFGRGSRIIVTTRDKHLLTSYGL |
ORF Type | 3prime_partial |
Blastp | TMV resistance protein N from Nicotiana with 41.13% of identity |
---|---|
Blastx | TMV resistance protein N from Nicotiana with 36.67% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452279.1) |
Pfam | NB-ARC domain (PF00931.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer