| Transcript | Ll_transcript_111666 |
|---|---|
| CDS coordinates | 323-634 (+) |
| Peptide sequence | MGGIGKTTLADVVYNRIKSKFDFSCFLPNVREAYNEGDQGLVKLQDKLLSQYKPKSMVIDTARQGKDMIKNFLQNKKVLLVLDDVNAEIQLEHLAGNQNWFGGG |
| ORF Type | 3prime_partial |
| Blastp | TMV resistance protein N from Nicotiana with 39.64% of identity |
|---|---|
| Blastx | TMV resistance protein N from Nicotiana with 34.34% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019452279.1) |
| Pfam | NB-ARC domain (PF00931.21) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer