Protein coding transcript 199195

• Transcript: Ll_transcript_111041
• CDS coordinates: 1759-2169 (+)
• Peptide sequence: MHLKKISRELRKQLFGRSKRWNDRGGSRSRSPPRSRAYEEHSHSGRGSGRRDFDRYHDSRDRRPRSRSPRRREKRSRSPVDRNARRTRESSAERRAKIEQWNREKELQDSGNKNNTNSNDHDEQGAAQNGIESGNH*
• ORF Type: complete

Annotations of Ll_transcript_111041

• Blastp: Splicing factor U2af small subunit B from Arabidopsis with 41.74% of identity
• Blastx: Splicing factor U2af small subunit B from Arabidopsis with 83.21% of identity
• Eggnog: auxiliary factor(ENOG410Z5PX)
• Kegg: Link to kegg annotations (AT5G42820)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414717.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;