Transcript | Ll_transcript_110332 |
---|---|
CDS coordinates | 1-402 (+) |
Peptide sequence | EVKNIEKTLPSNNYSFSVQIEEKKSGMASFGSLKSAIFEREERKQQYQAHIRGLNAYDRHKKFINDYVSIYGKEKHSTLKLPIKTDQDTLREGYRFIRSEEDDMDPSWEQRLVKRYYDKLFKEYPFQKNIFFQ* |
ORF Type | 5prime_partial |
Blastp | Protein FRA10AC1 from Homo with 43.12% of identity |
---|---|
Blastx | Protein FRA10AC1 from Homo with 43.52% of identity |
Eggnog | Fragile site, folic acid type, rare, fra(10)(Q23.3) or fra(10)(Q24.2) candidate 1(ENOG410YN91) |
Kegg | Link to kegg annotations (118924) |
CantataDB | Link to cantataDB annotations (CNT0000357) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449595.1) |
Pfam | Folate-sensitive fragile site protein Fra10Ac1 (PF09725.8) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer