Protein coding transcript 199273

• Transcript: Ll_transcript_110332
• CDS coordinates: 1-402 (+)
• Peptide sequence: EVKNIEKTLPSNNYSFSVQIEEKKSGMASFGSLKSAIFEREERKQQYQAHIRGLNAYDRHKKFINDYVSIYGKEKHSTLKLPIKTDQDTLREGYRFIRSEEDDMDPSWEQRLVKRYYDKLFKEYPFQKNIFFQ*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_110332

• Blastp: Protein FRA10AC1 from Homo with 43.12% of identity
• Blastx: Protein FRA10AC1 from Homo with 43.52% of identity
• Eggnog: Fragile site, folic acid type, rare, fra(10)(Q23.3) or fra(10)(Q24.2) candidate 1(ENOG410YN91)
• Kegg: Link to kegg annotations (118924)
• CantataDB: Link to cantataDB annotations (CNT0000357)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449595.1)
• Pfam: Folate-sensitive fragile site protein Fra10Ac1 (PF09725.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;