Protein coding transcript 199283

• Transcript: Ll_transcript_110300
• CDS coordinates: 128-847 (+)
• Peptide sequence: MATTTTTKILWPCSSTRISTLLTMRLFSTTTTATSIIKPPPLPFLSLPIRRSLLPLSNATTRFGGIRCRVNRAGDSAYSPINSGSSFSDRPPTEMAPLFPGCDYQHWLIVMDKPGGEGATKQQMIDSYVQTLAKVLGSEEEAIKKIYNVSCERYFGFGCEIDEETSNTLEGLPGVLFVLPDSYVDPEYKDYGAELFVNGEIVQRSPERQRRVEPQPQRHQDRPRYNDRTRYVRRRENMR*
• ORF Type: complete

Annotations of Ll_transcript_110300

• Blastp: Multiple organellar RNA editing factor 2, chloroplastic from Arabidopsis with 74.46% of identity
• Blastx: Multiple organellar RNA editing factor 2, chloroplastic from Arabidopsis with 85.92% of identity
• Eggnog: DAG protein(ENOG410YAFM)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014514708.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;