Protein coding transcript 19935

• Transcript: Ll_transcript_417991
• CDS coordinates: 319-876 (+)
• Peptide sequence: MQKSGSTKDVQYRNTECLNCNEDKPEDLNVHTVEMKKGDWTCPECSFMNFSRNTRCLKCRKAAPPKMFSTDEVERKKGDWTCSQCGFMNFASNAKCLRCPELRPKTHPGDWNCPKCDFMNFSGKLKCFRCQEPNPSPKKHPGDWSCPKCDFYNYSRNMACLKCNTGRPEDQPTSEYEEHVWRRSR*
• ORF Type: complete

Annotations of Ll_transcript_417991

• Blastp: Zinc finger protein VAR3, chloroplastic from Arabidopsis with 51.61% of identity
• Blastx: Zinc finger protein VAR3, chloroplastic from Arabidopsis with 51.61% of identity
• Eggnog: zinc finger(ENOG410YNCK)
• Kegg: Link to kegg annotations (AT5G17790)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430472.1)
• Pfam: Zn-finger in Ran binding protein and others (PF00641.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;