Protein coding transcript 1994

• Transcript: Ll_transcript_355440
• CDS coordinates: 846-1271 (+)
• Peptide sequence: MMFSIFHMMGVVAFLIRVLMKWCLLLQVAERALYLWNNDHIESLIQQNRKVILPIIFPALERSGGAHWNQVVQSLTLNVRKIFTNADPELFEECLDNFQEDEAKLKEKTKHEATWKVIEEIATSKVASNEAILVSTPTFSR*
• ORF Type: complete

Annotations of Ll_transcript_355440

• Blastp: Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit B' gamma isoform from Arabidopsis with 64.66% of identity
• Blastx: Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit B' gamma isoform from Arabidopsis with 63.2% of identity
• Eggnog: Protein phosphatase 2, regulatory subunit B(ENOG410XQJW)
• Kegg: Link to kegg annotations (AT4G15415)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464288.1)
• Pfam: Protein phosphatase 2A regulatory B subunit (B56 family) (PF01603.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;