Protein coding transcript 199440

• Transcript: Ll_transcript_74828
• CDS coordinates: 30-539 (+)
• Peptide sequence: MQNSFVHKLVSQTQNHFISQRTIFHNHTHTFRHRVFTSLTKPNTSQQRHHIPNSFFTHPLHPFHSHHSFSTTIPGFLSKPLITRLKTLFHCSSKLPTVFFRRQSFDFNQISNFYQRNWRSWIHRLTPHEVVLGLIGANVAVFLLWRIADENFMTNNFTVCILIYNLRST*
• ORF Type: complete

Annotations of Ll_transcript_74828

• Blastp: RHOMBOID-like protein 12, mitochondrial from Arabidopsis with 34.04% of identity
• Blastx: RHOMBOID-like protein 12, mitochondrial from Arabidopsis with 68.31% of identity
• Eggnog: rhomboid family(COG0705)
• Kegg: Link to kegg annotations (AT1G18600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442150.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;