Protein coding transcript 199446

• Transcript: Ll_transcript_74829
• CDS coordinates: 30-917 (+)
• Peptide sequence: MQNSFVHKLVSQTQNHFISQRTIFHNHTHTFRHRVFTSLTKPNTSQQRHHIPNSFFTHPLHPFHSHHSFSTTIPGFLSKPLITRLKTLFHCSSKLPTVFFRRQSFDFNQISNFYQRNWRSWIHRLTPHEVVLGLIGANVAVFLLWRIADENFMTNNFTISLDNIESGRLHTVITNAFSHIETGHIISNMIGLYFFGTNIGRSFGTEFLLKLYFAGAVGGAVFYLVHQVYKAQTSKLSWRSKELALGASAAVNAIMLLDIFLFPKATLYFNFIIPVPAMLLGIYLIGKDMLLILEE*
• ORF Type: complete

Annotations of Ll_transcript_74829

• Blastp: RHOMBOID-like protein 12, mitochondrial from Arabidopsis with 51.79% of identity
• Blastx: RHOMBOID-like protein 12, mitochondrial from Arabidopsis with 51.41% of identity
• Eggnog: rhomboid family(COG0705)
• Kegg: Link to kegg annotations (AT1G18600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463114.1)
• Pfam: Rhomboid family (PF01694.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;