Protein coding transcript 199451

• Transcript: Ll_transcript_74835
• CDS coordinates: 1350-1700 (+)
• Peptide sequence: MIGLYFFGTNIGRSFGTEFLLKLYFAGAVGGAVFYLVHQVYKAQTSKLSWRSKELALVSFCSYSIVMVSSSLSSETLISDNICSWWWLFNCFLRAKYFHAILSDFILCDSLKDLSV*
• ORF Type: complete

Annotations of Ll_transcript_74835

• Blastp: RHOMBOID-like protein 12, mitochondrial from Arabidopsis with 70.21% of identity
• Blastx: RHOMBOID-like protein 12, mitochondrial from Arabidopsis with 72.73% of identity
• Eggnog: rhomboid family(COG0705)
• Kegg: Link to kegg annotations (AT1G18600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442150.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;