Protein coding transcript 19951

• Transcript: Ll_transcript_418115
• CDS coordinates: 1377-1817 (+)
• Peptide sequence: MLDEVIEYLKQLQAQLQMMNRINMSSMMLPMAMQQQLQMSMMAGPMGMGMGMGMGMNIPGMDMNTMNRSNIPGMPPILHPSAFMSMPSWDGGGGDRVQGPPAPVMPDPSMFPFFGCQAQPMNMDAYSRIAAMYQQMHQPPPSGSKN*
• ORF Type: complete

Annotations of Ll_transcript_418115

• Blastp: Transcription factor UNE10 from Arabidopsis with 41.01% of identity
• Blastx: Transcription factor UNE10 from Arabidopsis with 42.36% of identity
• Eggnog: Transcription factor(ENOG4111B0G)
• Kegg: Link to kegg annotations (AT4G00050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414022.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;