Protein coding transcript 199520

• Transcript: Ll_transcript_76364
• CDS coordinates: 3-440 (+)
• Peptide sequence: TSFPLFIVNFISFPYCIVLFFLTILIILVFSVPGFTSYVIHLFCKISLFMVLMCVLLAPSFPFGFPEVLEGEIFLQNLPSIVAAHALDPQRGERILDMCAAPGGKTTAIAILMKDEGEIIATDRSHNKVEILNPSKNACFSYLLV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_76364

• Blastp: Putative methyltransferase NSUN6 from Mus with 61.54% of identity
• Blastx: Putative methyltransferase NSUN6 from Mus with 60.76% of identity
• Eggnog: nOP2 Sun(COG0144)
• Kegg: Link to kegg annotations (74455)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435108.1)
• Pfam: 16S rRNA methyltransferase RsmB/F (PF01189.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;