Protein coding transcript 199525

• Transcript: Ll_transcript_76338
• CDS coordinates: 742-1911 (+)
• Peptide sequence: MTRGTVLQGPQTDPYHFERSGLYIGQGTAMLSRAGMFRVSEGVGVDMKNRVYKLPSFHKVLEGEIFLQNLPSIVAAHALDPQRGERILDMCAAPGGKTTAIAILMKDEGEIIATDRSHNKVLDIQKLAAEMGLTCIKPRKLDALKSVCQINEFDMSTGPCCSDANNGVTNHVSGSPNLQVDTISSIVTERPKTNTVEENGKDVKADDKAYVSKADIRKNMRRMRNGPGRNQRLVAKVDSSKGFPPDSFDRVLLDAPCSALGLRPRLFAGEETVESLRKHAKYQRKMFDQAVQLARPGGVIVYSTCTINPGENEALVRYALDKYKYLSLAPQHPRIGGPGLIGRFEFPDGYAEEWLRPGEEDLVQRFDPSSPLDTIGFFIAKFAVGSKDA*
• ORF Type: complete

Annotations of Ll_transcript_76338

• Blastp: Putative methyltransferase NSUN6 from Mus with 47.41% of identity
• Blastx: Putative methyltransferase NSUN6 from Mus with 39.51% of identity
• Eggnog: nOP2 Sun(COG0144)
• Kegg: Link to kegg annotations (74455)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435108.1)
• Pfam: 16S rRNA methyltransferase RsmB/F (PF01189.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;