Protein coding transcript 199552

• Transcript: Ll_transcript_74446
• CDS coordinates: 1874-2374 (+)
• Peptide sequence: MLRTVCEFGSSQHPSVQCMEALRVAVVEQGNIDPYSIYTPPCNDTSALRSGLKGRYPWMSRAYDPCTERHSDVYYNLPEVQEALHANVTGIPYLWKTCSDIVGNYWTDSPLSMLPIYRELIDAGLKIWVYSGDTDSVVPVTATRYSIDALKLPTIINWYPWYDNGKV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_74446

• Blastp: Serine carboxypeptidase-like 27 from Arabidopsis with 75.45% of identity
• Blastx: Serine carboxypeptidase-like 27 from Arabidopsis with 78.28% of identity
• Eggnog: carboxy-peptidase(COG2939)
• Kegg: Link to kegg annotations (AT3G07990)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441943.1)
• Pfam: Serine carboxypeptidase (PF00450.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;