Transcript | Ll_transcript_75820 |
---|---|
CDS coordinates | 631-930 (+) |
Peptide sequence | MGTTSSSFFPKFLFRALAVVGLVCLLVVGSISASGRTRQEATQRSSKILEHEQVMGRDNKHANTEELDFNNMSKRRVPNGPDPIHNRKAGNAGRTPGKA* |
ORF Type | complete |
Blastp | CLAVATA3/ESR (CLE)-related protein 25 from Arabidopsis with 35.71% of identity |
---|---|
Blastx | - |
Eggnog | clavata3 esr-related 25(ENOG41115VN) |
Kegg | Link to kegg annotations (AT3G28455) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445523.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer