| Transcript | Ll_transcript_75826 |
|---|---|
| CDS coordinates | 673-978 (+) |
| Peptide sequence | MHMGTSSGYFLPKFFFRSLAVVGFVCLLVVGSISSDRTTKLEATKWSSERLKHGKVIGRDNKPVKNEELDFNYMSKRRVPNGPDPIHNRRAGKYGQSPGKS* |
| ORF Type | complete |
| Blastp | CLAVATA3/ESR (CLE)-related protein 25 from Arabidopsis with 35.62% of identity |
|---|---|
| Blastx | - |
| Eggnog | clavata3 esr-related 25(ENOG41115VN) |
| Kegg | Link to kegg annotations (AT3G28455) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019421461.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer