Transcript | Ll_transcript_75996 |
---|---|
CDS coordinates | 172-1530 (+) |
Peptide sequence | MWTPTPETLASTKTALSVAASLAATAVLLRSTVNDLIPDTVYNYFNSNFRKFSNRLSSHLTIIIEEHDGLTANQMFDTANVYVGSKQQSSAQRIKVHKPLKEEHLQVNIDKNQEFYDSYKGIKLKWVLVSMQNNNINLHNKRDSHNNASFHRVEVRHFELTFHKKHRDTVLGSYLHHVLHEAEAIREGKKTLKLHTIDYNGTDYWNSIVLNHPATFDTVAMEPEMKVQLLEDLCKFLDRKEYYKRVGKSWKRGYLLYGPPGTGKSSLIAAMANHLKFDIYDMDLREVQCNSDLRRLLIGTGSRSILVIEDIDCSVKLHNREVNNNGEDEDKVTLSGLLNFIDGLWSSCGDERIIIFTTNYKDRLDPALLRPGRMDMHIHMSYCSFSGFKTLAANYLRIQNHPLFEDIEGLLHKVNATPAEVAGELMKSDNTDSAIKGLISFLQCKQPGITTP* |
ORF Type | complete |
Blastp | AAA-ATPase At3g50940 from Arabidopsis with 51.56% of identity |
---|---|
Blastx | AAA-ATPase At3g50940 from Arabidopsis with 51.93% of identity |
Eggnog | Acts as a processive, ATP-dependent zinc metallopeptidase for both cytoplasmic and membrane proteins. Plays a role in the quality control of integral membrane proteins (By similarity)(COG0465) |
Kegg | Link to kegg annotations (AT3G50940) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019457304.1) |
Pfam | Domain associated at C-terminal with AAA (PF14363.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer