Protein coding transcript 199598

• Transcript: Ll_transcript_75996
• CDS coordinates: 172-1530 (+)
• Peptide sequence: MWTPTPETLASTKTALSVAASLAATAVLLRSTVNDLIPDTVYNYFNSNFRKFSNRLSSHLTIIIEEHDGLTANQMFDTANVYVGSKQQSSAQRIKVHKPLKEEHLQVNIDKNQEFYDSYKGIKLKWVLVSMQNNNINLHNKRDSHNNASFHRVEVRHFELTFHKKHRDTVLGSYLHHVLHEAEAIREGKKTLKLHTIDYNGTDYWNSIVLNHPATFDTVAMEPEMKVQLLEDLCKFLDRKEYYKRVGKSWKRGYLLYGPPGTGKSSLIAAMANHLKFDIYDMDLREVQCNSDLRRLLIGTGSRSILVIEDIDCSVKLHNREVNNNGEDEDKVTLSGLLNFIDGLWSSCGDERIIIFTTNYKDRLDPALLRPGRMDMHIHMSYCSFSGFKTLAANYLRIQNHPLFEDIEGLLHKVNATPAEVAGELMKSDNTDSAIKGLISFLQCKQPGITTP*
• ORF Type: complete

Annotations of Ll_transcript_75996

• Blastp: AAA-ATPase At3g50940 from Arabidopsis with 51.56% of identity
• Blastx: AAA-ATPase At3g50940 from Arabidopsis with 51.93% of identity
• Eggnog: Acts as a processive, ATP-dependent zinc metallopeptidase for both cytoplasmic and membrane proteins. Plays a role in the quality control of integral membrane proteins (By similarity)(COG0465)
• Kegg: Link to kegg annotations (AT3G50940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457304.1)
• Pfam: Domain associated at C-terminal with AAA (PF14363.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;