Protein coding transcript 199703

• Transcript: Ll_transcript_75752
• CDS coordinates: 3-515 (+)
• Peptide sequence: TYNNSFHSSIGMAPYEALYGRKCRTPLCWFETGENLMLGPDVVQQTTEKIRTIREHMKTAQSRQKSYYDKRRNPLSFEEGDHVFLRVVPTTGIGRILKARKLTPKFIGPYQIIGKVGPVAYRIALPPLLSSLHNVFHVSQLRKYISDPSHVIEPDSIQLKDNFTFETLPVK
• ORF Type: internal

Annotations of Ll_transcript_75752

• Blastp: Transposon Tf2-9 polyprotein from Schizosaccharomyces with 31.79% of identity
• Blastx: Transposon Tf2-9 polyprotein from Schizosaccharomyces with 31.79% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC167.08)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431322.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;