Protein coding transcript 199708

• Transcript: Ll_transcript_75738
• CDS coordinates: 425-859 (+)
• Peptide sequence: MTWIVKYLHNEPKLLESVKAEQKAIEKSNEGNLPLSWNQTRNMPITYKVVLESLRMASIISFPFREAVADVEYKGFLIPKGWKAMPLFRNIHHNPEFFPEPKKFNPSRFEVAPKPNTFMPFGSGVHSCPGNELAKLEILIMIHHL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_75738

• Blastp: Abscisic acid 8'-hydroxylase 3 from Oryza sativa with 76.03% of identity
• Blastx: Abscisic acid 8'-hydroxylase 4 from Arabidopsis with 70.5% of identity
• Eggnog: Cytochrome p450(COG2124)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433227.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;