Protein coding transcript 199716

• Transcript: Ll_transcript_74530
• CDS coordinates: 318-2153 (+)
• Peptide sequence: MAHKAMTSSHGNAHSEGAEMEQIITEFFAKSIHIILESRALYASSRNSFGDQVVSSPSSSSSSSSSVRPRDKWFNLALRECPAALENMDLWRQSNLEPIVIDVVLVQRPVNWDPTSCPLKKVLPRSSSMKERYPFSWNSDQEELGIETKSDKIIERWVLQYESGKTRDSNSNSRRSSNISLHTLYKKSTLLLRSLYSTVRLLPAHKTFRELNSSAQIHPFTLVHRISSFIEPFTRREEAEMLKFGFTPVDTASGRLCLSVMYLPSASEVSSEPTTPMSPQVITDYVGSPLADPLRRYPLIPVTGLPSYGSPSSLPFSRRHSWSYDHFRASSPSIACSPSPTYSESHTSVSIANYRHFPPASLPPQPTELSLIQKRNTGFDDRYPHPSHSIDNFGSLPTKTILRTESAPVRIPASEVTNSPDTNMSMQTGATAEKLFSLGKDEPRKYSGVKISANSSPHISFSRSSSRSYQDDFDDSDFTCPFNEDDLTDPETRAESFDHGHMADALEAGGFFPIRKSHDAAVGTLVHLLKKAPPLRQDLSTSEHLSQGAHSEIWNNNIKEPNQTPDAPMPVSMMSSGLIATRKTTADALEEFHSYREMKNLLLTGGRKNQI*
• ORF Type: complete

Annotations of Ll_transcript_74530

• Blastp: Autophagy-related protein 13b from Arabidopsis with 52.65% of identity
• Blastx: Autophagy-related protein 13b from Arabidopsis with 51.04% of identity
• Eggnog: Activates the ATG1 kinase in a nutritional condition dependent manner through the TOR pathway, leading to autophagy. Also invoved in cytoplasm to vacuole transport (Cvt) and more specifically in Cvt vesicle formation. Seems to play a role in the switching machinery regulating the conversion between the Cvt pathway and autophagy. Finally, ATG13 is also required for glycogen storage during stationary phase (By similarity)(ENOG410Y4BP)
• Kegg: Link to kegg annotations (AT3G18770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462868.1)
• Pfam: Autophagy-related protein 13 (PF10033.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;