Protein coding transcript 199722

• Transcript: Ll_transcript_76916
• CDS coordinates: 1-450 (+)
• Peptide sequence: DHLRVQGPSLEKTKYHSFIGIPFFLSQMGRHSSSVKQKLRKGLWSPDEDEKLFNYITRFGVGCWSSVPKLAGLQRCGKSCRLRWINYLRPDLKRGSFTDEEEQIIIDVHRILGNRWAQIAKHLPGRTDNEVKNFWNSCIKKKLISQGLDP
• ORF Type: internal

Annotations of Ll_transcript_76916

• Blastp: Transcription factor MYB86 from Arabidopsis with 78.86% of identity
• Blastx: Transcription factor MYB86 from Arabidopsis with 78.86% of identity
• Eggnog: Myblike DNAbinding domain containing protein(COG5147)
• Kegg: Link to kegg annotations (AT5G26660)
• CantataDB: Link to cantataDB annotations (CNT0000269)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463949.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;