Protein coding transcript 199793

• Transcript: Ll_transcript_77088
• CDS coordinates: 1-621 (+)
• Peptide sequence: RLGFVIDFLSKATLVGFMAGAAIIVSLQQLKGLLGILHFTNKMQIISVLHSVFNQKHEWSWQTILLGLTFLAFLLTARHISLRKPKLFWISAAAPLTSVILSTIIVFLMRNKLHNIAIIGELPKGVNPPSLNMLCFNGPYLALAIKTGLVTGILSLTEGIAVGRTFAALKNYQVDGNKEMMAIGLMNIAGSCSSCYVTSGNDSSLI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_77088

• Blastp: Probable sulfate transporter 3.4 from Arabidopsis with 75.37% of identity
• Blastx: Probable sulfate transporter 3.4 from Arabidopsis with 78.97% of identity
• Eggnog: sulfate transporter(COG0659)
• Kegg: Link to kegg annotations (AT3G15990)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425089.1)
• Pfam: Sulfate permease family (PF00916.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;