Protein coding transcript 199811

• Transcript: Ll_transcript_77074
• CDS coordinates: 743-1369 (+)
• Peptide sequence: MGSMLSESVSFTQDPILYLKLAFTATFFAGVFQASLGLLRLGFVIDFLSKATLVGFMAGAAVIVSLQQLKGLLGIVHFTTKMQIVPVLISVFKQRDEWSWQTIVMGFGFLAFLLTTRHISLKKPKLFWVSAAAPLASVILSTILVFLVRNKTHKIAIIGNLPKGLNPPSSNMLYFNGPFLALAMKTGLVTGILSLTVSLLEKLTSKMF*
• ORF Type: complete

Annotations of Ll_transcript_77074

• Blastp: Probable sulfate transporter 3.4 from Arabidopsis with 81.63% of identity
• Blastx: Probable sulfate transporter 3.4 from Arabidopsis with 83.54% of identity
• Eggnog: sulfate transporter(COG0659)
• Kegg: Link to kegg annotations (AT3G15990)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436417.1)
• Pfam: Sulfate permease family (PF00916.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;