Protein coding transcript 199865

• Transcript: Ll_transcript_76857
• CDS coordinates: 298-831 (+)
• Peptide sequence: MKASLLYSSQQQNTNSSSYSSSSLSPSMGMVYADMGALSLCPNYGAAVSTSQDCLAPNGGSSWSFPFTRDYHIASNFEEQPNNSDIVMEYKGSDCSDDGVGENSEQTNQNANTNEENPNENHTSGKEVDTSGQSKLCARGHWRPAEDSKLKELVALYGPQNWNLIAEKLEGRSGWKN*
• ORF Type: complete

Annotations of Ll_transcript_76857

• Blastp: Transcription factor CSA from Oryza sativa with 90% of identity
• Blastx: Transcription factor MYB105 from Arabidopsis with 91.89% of identity
• Eggnog: Myblike DNAbinding domain containing protein(COG5147)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445937.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;