Protein coding transcript 199869

• Transcript: Ll_transcript_76861
• CDS coordinates: 298-1221 (+)
• Peptide sequence: MKASLLYSSQQQNTNSSSYSSSSLSPSMGIVYADMGTLSLCPNYGVAGSSWGFPFMRECNIAQFEEQPNNSDVVMEDKGSDCSDGVGENSEKINISEENSNENHVSGKEVDTSGQSKLCARGHWRPAEDSKLKELVALYGPQNWNLIAEKLEGRSGKSCRLRWFNQLDPRINRRAFSEEEEERLMQAHRIYGNKWAMIARLFPGRTDNAVKNHWHVIMARKYREQSSAYRRRRLNQSVHRRMDEDTTNFISKDTTATGREPPPPPYCLNLPNTLATFPYASPSFHGGCSGGVEFGLNGSTHMIGGREA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_76861

• Blastp: Transcription factor MYB117 from Arabidopsis with 63.78% of identity
• Blastx: Transcription factor MYB105 from Arabidopsis with 78.83% of identity
• Eggnog: Myblike DNAbinding domain containing protein(COG5147)
• Kegg: Link to kegg annotations (AT1G26780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432145.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;