| Transcript | Ll_transcript_321164 |
|---|---|
| CDS coordinates | 2-325 (+) |
| Peptide sequence | TMKSAGCYSSSTPLKDQGSNIYQSSGACQPICVDQNFAVMAMTEGSNCLCGDMLPSEDSKVSDDKCDTPCDGYDKEMCGGHNYFSVFLSGTKNNVDSYVGDEASSSSS |
| ORF Type | internal |
| Blastp | - |
|---|---|
| Blastx | Cell wall integrity and stress response component 3 from Saccharomyces with 37.36% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (YOL105C) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_020206101.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer