Transcript | Ll_transcript_74650 |
---|---|
CDS coordinates | 4937-5617 (+) |
Peptide sequence | MAVIGKQVETFIREFFDQNPLSHVGLVTIKDGIAHSLTELGGSPESHIKALMGKLECSGDASLQDALELVLGSLNQIPSYGHREVLILYSALSTCDPGDLMETIQKCKKSKIRCSVICLAAEMFICKHLCQDTGGTYSVALDETHFKELILEHAPSPPAIAEYATANLIKMGFPQRAAEGSVAICTCHEEAKTGGGYTCPRCKVRVCELPTECRICGLTLISSPHL* |
ORF Type | complete |
Blastp | General transcription factor IIH subunit 2 from Arabidopsis with 79.2% of identity |
---|---|
Blastx | General transcription factor IIH subunit 2 from Arabidopsis with 70.86% of identity |
Eggnog | Transcription factor(COG5151) |
Kegg | Link to kegg annotations (AT1G05055) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020998746.1) |
Pfam | Ssl1-like (PF04056.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer