Transcript | Ll_transcript_75557 |
---|---|
CDS coordinates | 98-568 (+) |
Peptide sequence | MQALFHHSFLFRSPYSISHSSSFSAMSSSLTLPSISFNKLHSSPSSNAFSRNFCSSHQRSRVSMKVSAGSQASVNDALFSDYKASNAFLFPGQGAQALGMGKEAQNVPAAAILYKKANDILGFDLLDICINGPKEKLDSTIISQVCFFILFNFLYF* |
ORF Type | complete |
Blastp | Malonyl-CoA-acyl carrier protein transacylase, mitochondrial from Mus with 45.31% of identity |
---|---|
Blastx | Malonyl-CoA-acyl carrier protein transacylase, mitochondrial from Mus with 45.31% of identity |
Eggnog | Malonyl coA-acyl carrier protein transacylase(COG0331) |
Kegg | Link to kegg annotations (223722) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419809.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer