Protein coding transcript 199912

• Transcript: Ll_transcript_75561
• CDS coordinates: 1475-2026 (+)
• Peptide sequence: MQDASDAAKSAMASVIGLDSEKVQQLCDAVNQEIPEAEKVQIANYLCPGNYAVSGGIKGIEVLESKAKSFKARMTIRLAVAGAFHTSFMEPAVSRLEAALAATEIITPKIPVISNVDAQPHADPDTIKKILARQVTSPVQWETTVKTLLTKGMKKGYELGPGKVIAGIVKRVDKSADIENIGA*
• ORF Type: complete

Annotations of Ll_transcript_75561

• Blastp: Malonyl CoA-acyl carrier protein transacylase from Bacillus with 39.08% of identity
• Blastx: Malonyl CoA-acyl carrier protein transacylase from Bacillus with 40.43% of identity
• Eggnog: Malonyl coA-acyl carrier protein transacylase(COG0331)
• Kegg: Link to kegg annotations (BSU15900)
• CantataDB: -
• Mirbase: gma-MIR4995 (MI0017861)
• Ncbi protein: Link to NCBI protein (XP_019439262.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;