Transcript | Ll_transcript_76592 |
---|---|
CDS coordinates | 241-795 (+) |
Peptide sequence | MSSPSKRRDMDLMKLMMSDYKVEMIDDGMQEFFVEFHGPKDSLYEDGVWKIRVELPDGYPYKSPSIGFVNKIYHPNVDEVSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNASDPLNDDAAALMMQDSAAYEQRVKEYCQKYAKAEDIGATKEESSSEEEVSEEDYSSSDDDAIAGKPDP* |
ORF Type | complete |
Blastp | Ubiquitin-conjugating enzyme E2 5 from Arabidopsis with 78.72% of identity |
---|---|
Blastx | Ubiquitin-conjugating enzyme E2 5 from Arabidopsis with 76.22% of identity |
Eggnog | ubiquitin-conjugating enzyme(ENOG410XRC5) |
Kegg | Link to kegg annotations (AT1G63800) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422661.1) |
Pfam | Ubiquitin-conjugating enzyme (PF00179.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer