Protein coding transcript 199919

• Transcript: Ll_transcript_76595
• CDS coordinates: 241-744 (+)
• Peptide sequence: MSSPSKRRDMDLMKLMMSDYKVEMIDDGMQEFFVEFHGPKDSLYEDGVWKIRVELPDGYPYKSPSIGFVNKIYHPNVDEVSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNASDPLNDDAAALMMQDSAAYEQRVKGSDPSLVSSVPLTRMLLVKGRGFLLCC*
• ORF Type: complete

Annotations of Ll_transcript_76595

• Blastp: Ubiquitin-conjugating enzyme E2 5 from Arabidopsis with 87.14% of identity
• Blastx: Ubiquitin-conjugating enzyme E2 5 from Arabidopsis with 87.14% of identity
• Eggnog: ubiquitin-conjugating enzyme(ENOG410XRC5)
• Kegg: Link to kegg annotations (AT1G63800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422661.1)
• Pfam: Ubiquitin-conjugating enzyme (PF00179.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;