Protein coding transcript 199931

• Transcript: Ll_transcript_75133
• CDS coordinates: 408-749 (+)
• Peptide sequence: MDSISRYDNDDGGVSGGVMMSMTRDTKPRLRWTPDLHHRFVDAVTKLGGPDKATPKSVLRLMGLKGLTLYHLKSHLQKYRLGQHTRKQNEEQHKENSSECILNLSSSLVYCLK*
• ORF Type: complete

Annotations of Ll_transcript_75133

• Blastp: Myb family transcription factor PHL11 from Arabidopsis with 69.61% of identity
• Blastx: Myb family transcription factor PHL11 from Arabidopsis with 65.38% of identity
• Eggnog: Myb-like DNA-binding domain(ENOG410YGU0)
• Kegg: Link to kegg annotations (AT5G45580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445244.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;