Protein coding transcript 199990

• Transcript: Ll_transcript_75637
• CDS coordinates: 182-1009 (+)
• Peptide sequence: MSMQGMLTSLLGNLSLLSYFAKKKEKEAMVVQTLGVVSTYVVIVQLALAETMPLPYFLATSVVVVSGLVLNFLNYFGLLNAGIWHFWEDFITVGGLAVLPQIMWSTFVPYIPNSILPGATAFVIAVLAVTMARNGKLSEEGVKFVGGISGWTATLLFMWMPVSQLWTNYLNPENMKGLSAFSILLAMIGNGLLLPRALLVRDFMWFTGSTWATLFYGYGNIACLRFLNIISNEFFLAATVGLVSWIGLTLWKDSVVHGYNSPLDSIHDLVSGPRR*
• ORF Type: complete

Annotations of Ll_transcript_75637

• Blastp: Maltose excess protein 1, chloroplastic from Arabidopsis with 67.84% of identity
• Blastx: Maltose excess protein 1, chloroplastic from Arabidopsis with 67.84% of identity
• Eggnog: maltose excess protein(ENOG410ZKZ6)
• Kegg: Link to kegg annotations (AT5G17520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464845.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;