Protein coding transcript 20007

• Transcript: Ll_transcript_418193
• CDS coordinates: 95-769 (+)
• Peptide sequence: MFYQYSLGKHIMSSHFSTHYHFPSLFSSSNHLSFPPPPSPSFFLPSFSSSKSSIGALSSETKHKQVFRWRAISKSQTREYPDLLEGGLATLKLHEIDVEDEKDEERDLNEVWNEIKKRVEAIKSILGSMEDGEITVSAYDTAWVALVEDVNGSGAPQFPSTLEWIAKNQIPDGSWGDSEIFIAHDRILNTLACVVALRSWNLHPEKCEKGKVTLLLLYKLIIIY*
• ORF Type: complete

Annotations of Ll_transcript_418193

• Blastp: Ent-copalyl diphosphate synthase, chloroplastic from Pisum with 57.07% of identity
• Blastx: Ent-copalyl diphosphate synthase, chloroplastic from Pisum with 63.76% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426487.1)
• Pfam: Prenyltransferase and squalene oxidase repeat (PF00432.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;